PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06220.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 661aa    MW: 72456.3 Da    PI: 10.2849
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06220.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.66.2e-095335781257
                                   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  12 kNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                    NR +A rs +RK  +++eLe+kv+ L++e ++L  +l  l+  +a
  Zmw_sc06220.1.g00030.1.am.mk 533 ANRQSAARSKERKMRYMAELEQKVQILQTEATTLSAQLTLLQRDSA 578
                                   5************************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-10522586IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.082530587IPR004827Basic-leucine zipper domain
CDDcd147034.72E-20531578No hitNo description
SuperFamilySSF579592.53E-9531576No hitNo description
PfamPF001703.1E-7532578IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.7E-8533578No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MPCRADGDGP DGSRLPDACT RWVPGAASRC KPHDDNGGAN QAPAPPRNPF EVAAHARGAS  60
FTLLTLARAN AIRSSPTRRL KCSIGSDQLF RFKEKSVFPF VVKVNAVPPY HYHYRGVVNR  120
KGSAQQKIHW ANIWCDREET ASIRNKEVMQ QQQWHMPYHE DALLRPGSSG SARARPSLQK  180
RRRDRHHIIT ATDGPDHLHS MCLHDCVGPT RFLAGRKPFF SQPLPSAPPP SSSSLYLSFV  240
FQSTRVAPQG ACGTEQGRKQ TGCRRAEATE AVRAVNRQTE GQPNGALKAP ARAKHRSIRF  300
HRRPPRLHRQ RQRQRSNGTS PPPPWPFRAT MNGAADAHAA SLMQQELLQA ARLQQQPPQG  360
MTSSMPTSNK PRLPGLPPTP PQRALDACMD VDPAARNTAH RRSRSDVPFD YFPPPKVEAG  420
WGGGHDDADE LFDSYLNLDG LDGVNNSSEE RRDDGDSRGS SMKTNGADSS ENESEEGAAA  480
DSRAAGIRLW AADGVEGLNK RGGPGGQPGA APAPRHARSL SMDSLIGNGK VLANRQSAAR  540
SKERKMRYMA ELEQKVQILQ TEATTLSAQL TLLQRDSAGI ATQNSELQFR IRAMEQQAQL  600
RDAVFVNVRC AKHERRLAVV LDTCSLEKLY PAAGVDDDML ACPRPVRGCS LTGHGSESRV  660
Q
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576